FCRL5 Peptide - C-terminal region
FCRL5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BXMAS1, CD307, DKFZp667E2019, DKFZp667F216, FCRH5, FLJ00333, FLJ00397, IRTA2, MGC119590, MGC119592, MGC119593, PRO820
UniProt
Q96RD9
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCRL5 Rabbit Polyclonal Antibody (orb584828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112571
Preservative
Lyophilized powder
AA Sequence
ALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881081-500 1x 500 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942171-500 1x 500 µL
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680979-500 1x 500 µL
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details