KTI12 Peptide - middle region
KTI12 Peptide - middle region
Product Specifications
Product Name Alternative
MGC20419, RP11-91A18.3, SBBI81, TOT4
UniProt
Q96EK9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KTI12 Rabbit Polyclonal Antibody (orb586360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_612426
Preservative
Lyophilized powder
AA Sequence
VPKELEREESGAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15279150 1 Vial
Lentiviral mouse S1pr2 shRNA (UAS) - Lentiviral mouse S1pr2 shRNA (UAS) (100)
Sign In for Pricing
View Details 
043596-ML490 100 µL
ULK1, phosphorylated (S317) (ULK1, KIAA0722, Serine/threonine-protein kinase ULK1, Autophagy-related protein 1 homolog, Unc-51-like kinase 1) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
PLY2-2T 250 mL
Assurance Grade Yttrium for AA and ICP 1000 ug/mL (1000 PPM) 250mL in 2% HNO3
Sign In for Pricing
View Details ELI-27900h 96 Tests
Human RAS guanyl-releasing protein 2, RASGRP2 ELISA KIT
Sign In for Pricing
View Details