Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KTI12 Peptide - middle region

KTI12 Peptide - middle region

Product Specifications

Product Name Alternative

MGC20419, RP11-91A18.3, SBBI81, TOT4

UniProt

Q96EK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KTI12 Rabbit Polyclonal Antibody (orb586360) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612426

Preservative

Lyophilized powder

AA Sequence

VPKELEREESGAAESPALVTPDSEKSAKHGSGAFYSPELLEALTLRFEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBAS Antibody
MBS8518696-01 0.05 mg

NBAS Antibody

Sign In for Pricing
View Details
NBAS Antibody
MBS8518696-02 0.1 mg

NBAS Antibody

Sign In for Pricing
View Details
NBAS Antibody
MBS8518696-03 0.1 mL (AF750)

NBAS Antibody

Sign In for Pricing
View Details
NBAS Antibody
MBS8518696-04 0.1 mL (AF405M)

NBAS Antibody

Sign In for Pricing
View Details
NBAS Antibody
MBS8518696-05 0.1 mL (AF546)

NBAS Antibody

Sign In for Pricing
View Details
NBAS Antibody
MBS8518696-06 0.1 mL (AF405L)

NBAS Antibody

Sign In for Pricing
View Details