Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL12 Peptide - middle region

MRPL12 Peptide - middle region

Product Specifications

Product Name Alternative

5c5-2, FLJ60124, L12mt, MGC8610, MRP-L31/34, MRPL7, MRPL7/L12, RPML12

UniProt

P52815

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL12 Rabbit Polyclonal Antibody (orb586367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002940

Preservative

Lyophilized powder

AA Sequence

KKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Jak2 Antibody (53B7) [DyLight 550]
NBP2-59451R 0.1 mL

Mouse Monoclonal Jak2 Antibody (53B7) [DyLight 550]

Sign In for Pricing
View Details
THTPA (NM_024328) Human Tagged ORF Clone Lentiviral Particle
RC200849L3V 200 µL

THTPA (NM_024328) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Mouse PSMA (N-6His)
C03W-01 10 µg

Recombinant Mouse PSMA (N-6His)

Sign In for Pricing
View Details
Recombinant Mouse PSMA (N-6His)
C03W-02 50 µg

Recombinant Mouse PSMA (N-6His)

Sign In for Pricing
View Details
Recombinant Mouse PSMA (N-6His)
C03W-03 500 µg

Recombinant Mouse PSMA (N-6His)

Sign In for Pricing
View Details
Recombinant Mouse PSMA (N-6His)
C03W-04 1 mg

Recombinant Mouse PSMA (N-6His)

Sign In for Pricing
View Details