Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL12 Peptide - middle region

MRPL12 Peptide - middle region

Product Specifications

Product Name Alternative

5c5-2, FLJ60124, L12mt, MGC8610, MRP-L31/34, MRPL7, MRPL7/L12, RPML12

UniProt

P52815

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL12 Rabbit Polyclonal Antibody (orb586367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002940

Preservative

Lyophilized powder

AA Sequence

KKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malectin/MLEC Rabbit Polyclonal Antibody
orb1786063 100 µg

Malectin/MLEC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIRAS3 AAV siRNA Pooled Vector
18241161 1.0 µg

DIRAS3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human CD242/ICAM4 Protein, N-His
orb2967881-01 50 µg

Recombinant Human CD242/ICAM4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD242/ICAM4 Protein, N-His
orb2967881-02 100 µg

Recombinant Human CD242/ICAM4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD242/ICAM4 Protein, N-His
orb2967881-03 1 mg

Recombinant Human CD242/ICAM4 Protein, N-His

Sign In for Pricing
View Details
Human Tumor necrosis factor Alpha induced protein 8 like protein 1 (TNFAIP8L1) ELISA kit
GTR10406569 96 Well

Human Tumor necrosis factor Alpha induced protein 8 like protein 1 (TNFAIP8L1) ELISA kit

Sign In for Pricing
View Details