LAIR1 Peptide - C-terminal region
LAIR1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD305, LAIR-1
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAIR1 Rabbit Polyclonal Antibody (orb331333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068352
Preservative
Lyophilized powder
AA Sequence
LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MGWSTDF-SB75/100 10x 96 Well Plates
Streptavidin High Binding Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
Sign In for Pricing
View Details ![Glucocorticoid Receptor alpha Mouse Monoclonal Antibody [3F2]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82a68/imageurl/em1701-66.webp)
EM1701-66 100 µL
Glucocorticoid Receptor alpha Mouse Monoclonal Antibody [3F2]
Sign In for Pricing
View Details 
