LAIR1 Peptide - C-terminal region
LAIR1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD305, LAIR-1
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAIR1 Rabbit Polyclonal Antibody (orb331333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068352
Preservative
Lyophilized powder
AA Sequence
LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#92266 1 Kit
Mix-n-StainTM Biotin Antibody Labeling Kit, 1x (20-50ug) labeling
Sign In for Pricing
View Details 
