Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMKN Peptide - C-terminal region

DMKN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ79374, FLJ79374, , UNQ729, ZD52F10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMKN Rabbit Polyclonal Antibody (orb326579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177276

Preservative

Lyophilized powder

AA Sequence

QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASF3 Antibody
MBS7132512-01 0.1 mL

WASF3 Antibody

Sign In for Pricing
View Details
WASF3 Antibody
MBS7132512-02 5x 0.1 mL

WASF3 Antibody

Sign In for Pricing
View Details
Olfr1380 Mouse shRNA Lentiviral Particle (Locus ID 404336)
TL508755V 500 µL Each

Olfr1380 Mouse shRNA Lentiviral Particle (Locus ID 404336)

Sign In for Pricing
View Details
Anti Human CD16 Flow Cytometry Monoclonal Clone 3G8 ER780  Ready To Use 100 Tests
IMSAHUCD163G8CER780100 100 Tests

Anti Human CD16 Flow Cytometry Monoclonal Clone 3G8 ER780 Ready To Use 100 Tests

Sign In for Pricing
View Details
α-Cyclohexyl-3,5-dimethylbenzenemethanol
OR1080848-01 250 mg

α-Cyclohexyl-3,5-dimethylbenzenemethanol

Sign In for Pricing
View Details
α-Cyclohexyl-3,5-dimethylbenzenemethanol
OR1080848-02 500 mg

α-Cyclohexyl-3,5-dimethylbenzenemethanol

Sign In for Pricing
View Details