Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMKN Peptide - C-terminal region

DMKN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ79374, FLJ79374, , UNQ729, ZD52F10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMKN Rabbit Polyclonal Antibody (orb326579) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177276

Preservative

Lyophilized powder

AA Sequence

QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgbd1 (NM_001162920) Mouse Tagged ORF Clone
MG212933 10 µg

Pgbd1 (NM_001162920) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lyn, NT (Lyn, Tyrosine-protein kinase Lyn, V-yes-1 Yamaguchi sarcoma viral related oncogene homolog, p53Lyn, p56Lyn) (PE) discontinued
038021-PE 200 µL

Lyn, NT (Lyn, Tyrosine-protein kinase Lyn, V-yes-1 Yamaguchi sarcoma viral related oncogene homolog, p53Lyn, p56Lyn) (PE) discontinued

Sign In for Pricing
View Details
Mouse Fission 1 (FIS1) ELISA Kit
orb1496459-01 48 Tests

Mouse Fission 1 (FIS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Fission 1 (FIS1) ELISA Kit
orb1496459-02 96 Tests

Mouse Fission 1 (FIS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal PPIL1 Antibody (08) [Alexa Fluor 488]
NBP3-06214AF488 0.1 mL

Mouse Monoclonal PPIL1 Antibody (08) [Alexa Fluor 488]

Sign In for Pricing
View Details
TMEM177 (Transmembrane Protein 177) (PE)
134506-PE 100 µL

TMEM177 (Transmembrane Protein 177) (PE)

Sign In for Pricing
View Details