Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR160 Peptide - C-terminal region

GPR160 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPCR1, GPCR150

UniProt

Q9UJ42

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR160 Rabbit Polyclonal Antibody (orb586437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055188

Preservative

Lyophilized powder

AA Sequence

FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF488A conjugate, 0.1mg/mL
BNC881384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629607 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Interleukin 34 (IL34) Mouse Monoclonal Antibody [Clone ID: OTI4A6]
CF811727 100 µg

Interleukin 34 (IL34) Mouse Monoclonal Antibody [Clone ID: OTI4A6]

Sign In for Pricing
View Details
E-Cadherin Recombinant Rabbit monoclonal Antibody
HA751488 100 µL

E-Cadherin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL
BNC681025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Cathepsin L/CTSL Protein (aa 1-334, His Tag)
PKSM040915 50 µg

Recombinant Mouse Cathepsin L/CTSL Protein (aa 1-334, His Tag)

Sign In for Pricing
View Details