Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR160 Peptide - C-terminal region

GPR160 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPCR1, GPCR150

UniProt

Q9UJ42

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR160 Rabbit Polyclonal Antibody (orb586437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055188

Preservative

Lyophilized powder

AA Sequence

FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21ORF56 (SPATC1L) (NM_001142854) Human Over-expression Lysate
LY428289 100 µg

C21ORF56 (SPATC1L) (NM_001142854) Human Over-expression Lysate

Sign In for Pricing
View Details
Neurofilament (NF-H) (RT-97), CF405S conjugate, 0.1mg/mL
BNC040454-100 1x 100 µL

Neurofilament (NF-H) (RT-97), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-,  20nm
GP-6301-20 1 mL

Colloidal Gold Conjugated Artocarpus integrifolia Lectin (Jackfruit) -Jacalin, AIA-, 20nm

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF647 conjugate, 0.1mg/mL
BNC472179-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (6E4/3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zinc Chloride Hydrate
TRC-Z900455-5G 5 g

Zinc Chloride Hydrate

Sign In for Pricing
View Details
MYO1A Rabbit Polyclonal Antibody
TA360791 100 µL

MYO1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details