Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDMA Peptide - C-terminal region

GSDMA Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG9, FLJ39120, GSDM, GSDM1, MGC129596

UniProt

Q96QA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDMA Rabbit Polyclonal Antibody (orb586439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835465

Preservative

Lyophilized powder

AA Sequence

ICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zuclopenthixol
TRC-Z701485-0.5MG 0.5 mg

Zuclopenthixol

Sign In for Pricing
View Details
OSBP1 (OSBP) Rabbit Polyclonal Antibody
TA342877 100 µL

OSBP1 (OSBP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal DISP1 Antibody [DyLight 488]
NBP2-81818G 0.1 mL

Rabbit Polyclonal DISP1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Lpcat2-set siRNA/shRNA/RNAi Lentivector (Mouse)
27556094 4x 500 ng

Lpcat2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Vom2r78 Protein Vector (Rat) (pPM-C-HA)
50157026 500 ng

Vom2r78 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea pig A kinase (PRKA) anchor protein (gravin) 12 ELISA Kit
MBS731968-01 48 Well

Guinea pig A kinase (PRKA) anchor protein (gravin) 12 ELISA Kit

Sign In for Pricing
View Details