Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSDMA Peptide - C-terminal region

GSDMA Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG9, FLJ39120, GSDM, GSDM1, MGC129596

UniProt

Q96QA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSDMA Rabbit Polyclonal Antibody (orb586439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835465

Preservative

Lyophilized powder

AA Sequence

ICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit
MBS9338001-01 48 Well

Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit
MBS9338001-02 96 Well

Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit
MBS9338001-03 5x 96 Well

Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit

Sign In for Pricing
View Details
Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit
MBS9338001-04 10x 96 Well

Rat Transmembrane 9 superfamily member 2, TM9SF2 ELISA Kit

Sign In for Pricing
View Details
Potassium/sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) Antibody (FITC)
abx443198 100 µg

Potassium/sodium Hyperpolarization-Activated Cyclic Nucleotide-Gated Channel 2 (HCN2) Antibody (FITC)

Sign In for Pricing
View Details
NUDT5 3'UTR Lenti-reporter-Luc Vector
32302081 1.0 µg

NUDT5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details