Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPN Peptide - C-terminal region

LIPN Peptide - C-terminal region

Product Specifications

Product Name Alternative

LIPL4, bA186O14.3

UniProt

Q5VXI9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPN Rabbit Polyclonal Antibody (orb586442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001095939

Preservative

Lyophilized powder

AA Sequence

IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFalpha (MF9), CF488A conjugate, 0.1mg/mL
BNC880644-500 1x 500 µL

TGFalpha (MF9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant MID1IP1 Antibody
RN-14576-01 50 μL

Recombinant MID1IP1 Antibody

Sign In for Pricing
View Details
Recombinant MID1IP1 Antibody
RN-14576-02 100 µL

Recombinant MID1IP1 Antibody

Sign In for Pricing
View Details
Recombinant MID1IP1 Antibody
RN-14576-03 1 mL

Recombinant MID1IP1 Antibody

Sign In for Pricing
View Details
Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody
TA374384 100 µL

Cyclin E1 (CCNE1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(5a,22R,23R,24S)-22,23-Dihydroxyergostan-3-one
TRC-D275140-500MG 500 mg

(5a,22R,23R,24S)-22,23-Dihydroxyergostan-3-one

Sign In for Pricing
View Details