Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPN Peptide - C-terminal region

LIPN Peptide - C-terminal region

Product Specifications

Product Name Alternative

LIPL4, bA186O14.3

UniProt

Q5VXI9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPN Rabbit Polyclonal Antibody (orb586442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001095939

Preservative

Lyophilized powder

AA Sequence

IFTRFFLLPNSIIKAVFGTKGFFLEDKKTKIASTKICNNKILWLICSEFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD69 Protein (aa 64-199, His Tag)
PKSH033694-01 10 µg

Recombinant Human CD69 Protein (aa 64-199, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD69 Protein (aa 64-199, His Tag)
PKSH033694-02 50 µg

Recombinant Human CD69 Protein (aa 64-199, His Tag)

Sign In for Pricing
View Details
EXO1 Polyclonal Antibody
E-AB-68337-01 60 µL

EXO1 Polyclonal Antibody

Sign In for Pricing
View Details
EXO1 Polyclonal Antibody
E-AB-68337-02 120 µL

EXO1 Polyclonal Antibody

Sign In for Pricing
View Details
EXO1 Polyclonal Antibody
E-AB-68337-03 200 µL

EXO1 Polyclonal Antibody

Sign In for Pricing
View Details
EnzyChrom™ Creatine Kinase Assay Kit
ECPK-100 100 Tests

EnzyChrom™ Creatine Kinase Assay Kit

Sign In for Pricing
View Details