Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPLAL1 Peptide - C-terminal region

LYPLAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ99730, KIAA1238

UniProt

Q5VWZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPLAL1 Rabbit Polyclonal Antibody (orb331335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620149

Preservative

Lyophilized powder

AA Sequence

EETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal dsRNA Antibody (1D3) - Azide and BSA Free
NBP3-20110-0.025mg 0.025 mg

Mouse Monoclonal dsRNA Antibody (1D3) - Azide and BSA Free

Sign In for Pricing
View Details
Mrpl51 Rat shRNA Lentiviral Particle (Locus ID 297601)
TL705198V 500 µL Each

Mrpl51 Rat shRNA Lentiviral Particle (Locus ID 297601)

Sign In for Pricing
View Details
VCP Antibody (YA2375, Rabbit)
HY-P82630-01 10 µL

VCP Antibody (YA2375, Rabbit)

Sign In for Pricing
View Details
VCP Antibody (YA2375, Rabbit)
HY-P82630-02 50 μL

VCP Antibody (YA2375, Rabbit)

Sign In for Pricing
View Details
VCP Antibody (YA2375, Rabbit)
HY-P82630-03 100 µL

VCP Antibody (YA2375, Rabbit)

Sign In for Pricing
View Details
Recombinant Halobacillus halophilus Small, acid-soluble spore protein 1 (Sh-1)
MBS1045303-01 0.02 mg (E-Coli)

Recombinant Halobacillus halophilus Small, acid-soluble spore protein 1 (Sh-1)

Sign In for Pricing
View Details