Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPLAL1 Peptide - C-terminal region

LYPLAL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ99730, KIAA1238

UniProt

Q5VWZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPLAL1 Rabbit Polyclonal Antibody (orb331335) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620149

Preservative

Lyophilized powder

AA Sequence

EETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM6 Antibody - C-terminal region (ARP39780_P050)
ARP39780_P050 100 µL

TRIM6 Antibody - C-terminal region (ARP39780_P050)

Sign In for Pricing
View Details
Scn9a Rat shRNA Plasmid (Locus ID 78956)
TL712585 1 Kit

Scn9a Rat shRNA Plasmid (Locus ID 78956)

Sign In for Pricing
View Details
NMDAR2A/B (Ab-1246/1252) Antibody
MBS858461-01 0.1 mg

NMDAR2A/B (Ab-1246/1252) Antibody

Sign In for Pricing
View Details
NMDAR2A/B (Ab-1246/1252) Antibody
MBS858461-02 0.1 mL (AF635)

NMDAR2A/B (Ab-1246/1252) Antibody

Sign In for Pricing
View Details
NMDAR2A/B (Ab-1246/1252) Antibody
MBS858461-03 0.1 mL (AF610)

NMDAR2A/B (Ab-1246/1252) Antibody

Sign In for Pricing
View Details
NMDAR2A/B (Ab-1246/1252) Antibody
MBS858461-04 0.1 mL (AF405S)

NMDAR2A/B (Ab-1246/1252) Antibody

Sign In for Pricing
View Details