Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFM1 Peptide - N-terminal region

OLFM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMY, NOE1, NOELIN1, OlfA

UniProt

Q6IMJ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OLFM1 Rabbit Polyclonal Antibody (orb586446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055094

Preservative

Lyophilized powder

AA Sequence

VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yipf1 Mouse Gene Knockout Kit (CRISPR)
KN519549 1 Kit

Yipf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS501211 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
HRP Conjugated Morniga M Lectin (black mulberry) -MNA-M-
H-9004-1 1 mg

HRP Conjugated Morniga M Lectin (black mulberry) -MNA-M-

Sign In for Pricing
View Details
ZNF773 Human Gene Knockout Kit (CRISPR)
KN401438 1 Kit

ZNF773 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin Anti-Mouse CD22 Antibody
RD20364F-01 25 µg

Biotin Anti-Mouse CD22 Antibody

Sign In for Pricing
View Details
Biotin Anti-Mouse CD22 Antibody
RD20364F-02 100 µg

Biotin Anti-Mouse CD22 Antibody

Sign In for Pricing
View Details