Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3 Peptide - C-terminal region

RCN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RLP49

UniProt

Q96D15

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCN3 Rabbit Polyclonal Antibody (orb586450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065701

Preservative

Lyophilized powder

AA Sequence

GHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]
TA813383AM 100 µL

DDX4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS702237 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF740 conjugate, 0.1mg/mL
BNC743795-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALG12 Human Gene Knockout Kit (CRISPR)
KN215501 1 Kit

ALG12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDAC9 Antibody
KC-638-01 50 μL

HDAC9 Antibody

Sign In for Pricing
View Details
HDAC9 Antibody
KC-638-02 100 µL

HDAC9 Antibody

Sign In for Pricing
View Details