Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3 Peptide - C-terminal region

RCN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RLP49

UniProt

Q96D15

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCN3 Rabbit Polyclonal Antibody (orb586450) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065701

Preservative

Lyophilized powder

AA Sequence

GHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carabron
TRC-C177555-5MG 5 mg

Carabron

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB24), Biotin conjugate, 0.1mg/mL
BNCB0024-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB24), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granzyme B Recombinant Rabbit monoclonal Antibody
HA723609 100 µL

Granzyme B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560317 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Yes1 Mouse Gene Knockout Kit (CRISPR)
KN519546 1 Kit

Yes1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Applied Cell Extracellular Matrix
G422 25 mL

Applied Cell Extracellular Matrix

Sign In for Pricing
View Details