SH2D4A Peptide - N-terminal region
SH2D4A Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ20967, SH2A, PPP1R38
UniProt
Q9H788
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SH2D4A Rabbit Polyclonal Antibody (orb331337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071354
Preservative
Lyophilized powder
AA Sequence
IWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401170-500 1x 500 µL
Vimentin (VM1170), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Alkyl DHAP synthase (AGPS) (158-384) Mouse Monoclonal Antibody [Clone ID: AGPS-03]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcdda/imageurl/am26765pu-n.webp)
AM26765PU-N 100 µg
Alkyl DHAP synthase (AGPS) (158-384) Mouse Monoclonal Antibody [Clone ID: AGPS-03]
Sign In for Pricing
View Details 
BNC042426-100 1x 100 µL
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 