Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH2D4A Peptide - N-terminal region

SH2D4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20967, SH2A, PPP1R38

UniProt

Q9H788

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH2D4A Rabbit Polyclonal Antibody (orb331337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071354

Preservative

Lyophilized powder

AA Sequence

IWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF3 (NM_007185) Human Recombinant Protein
TP308465M 100 µg

CELF3 (NM_007185) Human Recombinant Protein

Sign In for Pricing
View Details
S Protein Rabbit Polyclonal Antibody
TA381937 100 µL

S Protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DPT Hydrochloride
TRC-D678870-10MG 10 mg

DPT Hydrochloride

Sign In for Pricing
View Details
meso-2,3-Dimercaptosuccinic Acid
TRC-D446740-25G 25 g

meso-2,3-Dimercaptosuccinic Acid

Sign In for Pricing
View Details
TIPRL (NM_152902) Human Over-expression Lysate
LC403496 20 µg

TIPRL (NM_152902) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexyl 4-Aminobenzoate Hydrochloride
TRC-B412948-50MG 50 mg

Hexyl 4-Aminobenzoate Hydrochloride

Sign In for Pricing
View Details