Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D3 Peptide - C-terminal region

TBC1D3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ56187, FLJ60943, FLJ93850, PRC17, TBC1D3A, TBC1D3F

UniProt

Q8IZP1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBC1D3 Rabbit Polyclonal Antibody (orb586459) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116863

Preservative

Lyophilized powder

AA Sequence

NRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSASRPVPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNGT2 AAV siRNA Pooled Vector
22334161 1.0 µg

GNGT2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
2,7-Bis (alloxycarbonylamino) -9-chloroacridine
orb1941368-01 25 mg

2,7-Bis (alloxycarbonylamino) -9-chloroacridine

Sign In for Pricing
View Details
2,7-Bis (alloxycarbonylamino) -9-chloroacridine
orb1941368-02 50 mg

2,7-Bis (alloxycarbonylamino) -9-chloroacridine

Sign In for Pricing
View Details
2,7-Bis (alloxycarbonylamino) -9-chloroacridine
orb1941368-03 100 mg

2,7-Bis (alloxycarbonylamino) -9-chloroacridine

Sign In for Pricing
View Details
FGF21 ELISA Kit (Mouse)
OKEH00284-96W 96 Well

FGF21 ELISA Kit (Mouse)

Sign In for Pricing
View Details
TUBA1B CRISPR All-in-one AAV vector set (with saCas9)(Rat)
48792156 3x 1.0 µg DNA

TUBA1B CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details