Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD2 Peptide - C-terminal region

FSD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-127F21, SPRYD1

UniProt

A1L4K1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSD2 Rabbit Polyclonal Antibody (orb586545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007123

Preservative

Lyophilized powder

AA Sequence

DYRVGVAFADVRKQEDLGANCLSWCMRHTFASSRHKYEFLHNRTTPDIRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPOP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45367061 1.0 µg DNA

SPOP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
StemBoost™ Neuronal Fate Reprogramming Cocktail FICB (10X)
S244-1 1 mL

StemBoost™ Neuronal Fate Reprogramming Cocktail FICB (10X)

Sign In for Pricing
View Details
Olfr1178 Protein Vector (Mouse) (pPM-C-HA)
32642024 500 ng

Olfr1178 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Cystathionine beta-synthase ELISA Kit
MBS9427952-01 96 Tests

Human Cystathionine beta-synthase ELISA Kit

Sign In for Pricing
View Details
Human Cystathionine beta-synthase ELISA Kit
MBS9427952-02 5x 96 Tests

Human Cystathionine beta-synthase ELISA Kit

Sign In for Pricing
View Details
2,4-Difluoro-3-iodo-1,1'-biphenyl
PC1015006-01 500 mg

2,4-Difluoro-3-iodo-1,1'-biphenyl

Sign In for Pricing
View Details