Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - N-terminal region

UQCC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

B1AKV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UQCC1 Rabbit Polyclonal Antibody (orb326585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171906

Preservative

Lyophilized powder

AA Sequence

RCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Siglec-10 (C-Fc)
PKSM041425-01 10 µg

Recombinant Mouse Siglec-10 (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse Siglec-10 (C-Fc)
PKSM041425-02 50 µg

Recombinant Mouse Siglec-10 (C-Fc)

Sign In for Pricing
View Details
NIT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]
TA501084AM 100 µL

NIT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-500 1x 500 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS805655 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
RAB40A Human Gene Knockout Kit (CRISPR)
KN420169 1 Kit

RAB40A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details