Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - N-terminal region

UQCC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

B1AKV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UQCC1 Rabbit Polyclonal Antibody (orb326585) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001171906

Preservative

Lyophilized powder

AA Sequence

RCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LYSMD4 activation kit by CRISPRa
GA115531 1 Kit

Human LYSMD4 activation kit by CRISPRa

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL
BNC742316-100 1x 100 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin C (Ab-275) Antibody
8B8334-AAT 50 µg

Cyclin C (Ab-275) Antibody

Sign In for Pricing
View Details
FOXP3 Polyclonal Antibody
E-AB-70038-01 60 µL

FOXP3 Polyclonal Antibody

Sign In for Pricing
View Details
FOXP3 Polyclonal Antibody
E-AB-70038-02 120 µL

FOXP3 Polyclonal Antibody

Sign In for Pricing
View Details
FOXP3 Polyclonal Antibody
E-AB-70038-03 200 µL

FOXP3 Polyclonal Antibody

Sign In for Pricing
View Details