SYNRG Peptide - N-terminal region
SYNRG Peptide - N-terminal region
Product Specifications
Product Name Alternative
AP1GBP1, FLJ34482, MGC104959, SYNG
UniProt
B7ZKZ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SYNRG Rabbit Polyclonal Antibody (orb326584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157019
Preservative
Lyophilized powder
AA Sequence
QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx06539-500gEcoli 500 µg (E. coli)
Recombinant Mycoplasma Hyopneumoniae rplI Protein (aa 1-145) (strain 7448)
Sign In for Pricing
View Details 
NBP1-46111 0.1 mg
Goat Polyclonal Tight Junction Protein 1 Antibody
Sign In for Pricing
View Details 
490641 100 µL
RNF115 (E3 Ubiquitin-Protein Ligase RNF115, Ring Finger Protein 115)
Sign In for Pricing
View Details