Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNRG Peptide - N-terminal region

SYNRG Peptide - N-terminal region

Product Specifications

Product Name Alternative

AP1GBP1, FLJ34482, MGC104959, SYNG

UniProt

B7ZKZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNRG Rabbit Polyclonal Antibody (orb326584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157019

Preservative

Lyophilized powder

AA Sequence

QQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCMDC-135051
BA2102-5.1 1 mL (10 mM in DMSO)

TCMDC-135051

Sign In for Pricing
View Details
Stap2 CRISPR Activation Plasmid (m)
sc-430674-ACT 20 µg

Stap2 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
NRTN polyclonal antibody
BS76773-01 50 µL

NRTN polyclonal antibody

Sign In for Pricing
View Details
NRTN polyclonal antibody
BS76773-02 100 µL

NRTN polyclonal antibody

Sign In for Pricing
View Details
Zeb1 sgRNA CRISPR Lentivector set (Mouse)
K3807701 3x 1.0 µg

Zeb1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Reticular Fibroblasts and Reticular Fibers (Fibroblast Marker) (MaxLight 750)
MBS6257342-01 0.1 mL

Reticular Fibroblasts and Reticular Fibers (Fibroblast Marker) (MaxLight 750)

Sign In for Pricing
View Details