Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc3b Peptide - C-terminal region

Lrrc3b Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1311897

UniProt

D4A9I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrc3b Rabbit Polyclonal Antibody (orb581018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002725082

Preservative

Lyophilized powder

AA Sequence

MASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TTC31 activation kit by CRISPRa
GA112077 1 Kit

Human TTC31 activation kit by CRISPRa

Sign In for Pricing
View Details
EnzyChrom™ Sphingomyelin Assay Kit
ESML-100 100 Tests

EnzyChrom™ Sphingomyelin Assay Kit

Sign In for Pricing
View Details
FITC Anti-Human CD19 Antibody[CB19]
E-AB-F1004C-01 20 Tests

FITC Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
FITC Anti-Human CD19 Antibody[CB19]
E-AB-F1004C-02 100 Tests

FITC Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
FITC Anti-Human CD19 Antibody[CB19]
E-AB-F1004C-03 2x 100 Tests

FITC Anti-Human CD19 Antibody[CB19]

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details