Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc3b Peptide - C-terminal region

Lrrc3b Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1311897

UniProt

D4A9I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrc3b Rabbit Polyclonal Antibody (orb581018) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_002725082

Preservative

Lyophilized powder

AA Sequence

MASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS806057 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL
BNC683876-500 1x 500 µL

Human Immunoglobulin Alpha (IgA) Heavy Chain (rHISA43), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL
BNCB2054-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MASA (ENOPH1) (NM_021204) Human Recombinant Protein
TP309510 20 µg

MASA (ENOPH1) (NM_021204) Human Recombinant Protein

Sign In for Pricing
View Details
4-Chlorobutyl Acetate
TRC-C364805-25G 25 g

4-Chlorobutyl Acetate

Sign In for Pricing
View Details
alpha Synuclein (SNCA) Mouse Monoclonal Antibody [Clone ID: 2B2D1]
AM06128SU-N 100 µL

alpha Synuclein (SNCA) Mouse Monoclonal Antibody [Clone ID: 2B2D1]

Sign In for Pricing
View Details