Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtpbp4 Peptide - C-terminal region

Gtpbp4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Crfg

UniProt

F1LMK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtpbp4 Rabbit Polyclonal Antibody (orb582529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446141

Preservative

Lyophilized powder

AA Sequence

CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MSR1/SCARA1/CD204 Protein (His Tag)
PKSH031615 100 µg

Recombinant Human MSR1/SCARA1/CD204 Protein (His Tag)

Sign In for Pricing
View Details
Tissue Genomic DNA, Kidney
CD564923 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details
LDHA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA500568BM 100 µL

LDHA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF405S conjugate, 0.1mg/mL
BNC042148-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS801820 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
GPR161 Human Gene Knockout Kit (CRISPR)
KN215665 1 Kit

GPR161 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details