Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtpbp4 Peptide - C-terminal region

Gtpbp4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Crfg

UniProt

F1LMK5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtpbp4 Rabbit Polyclonal Antibody (orb582529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446141

Preservative

Lyophilized powder

AA Sequence

CSKTPRDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AREL1 Antibody
OC-251-01 50 μL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
OC-251-02 100 µL

AREL1 Antibody

Sign In for Pricing
View Details
AREL1 Antibody
OC-251-03 1 mL

AREL1 Antibody

Sign In for Pricing
View Details
Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL
BNC741201-100 1x 100 µL

Neurofilament (H+L) (RT-97 + NR-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody
HA723315 100 µL

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PAK6 Human Gene Knockout Kit (CRISPR)
KN207438LP 1 Kit

PAK6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details