Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERI3 Peptide - C-terminal region

ERI3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ22943, MGC2683, PINT1, PRNPIP

UniProt

O43414

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERI3 Rabbit Polyclonal Antibody (orb586257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076971

Preservative

Lyophilized powder

AA Sequence

KAYSFAMGCWPKNGLLDMNKGLSLQHIGRPHSGIDDCKNIANIMKTLAYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF167 Antibody
GWB-MP401E 50 µg

RNF167 Antibody

Sign In for Pricing
View Details
3- (4-tert-Butyl-phenyl) -propionic acid
sc-309972 500 mg

3- (4-tert-Butyl-phenyl) -propionic acid

Sign In for Pricing
View Details
Recombinant Human TFPI Protein
ARP4171-01 10 µg

Recombinant Human TFPI Protein

Sign In for Pricing
View Details
Recombinant Human TFPI Protein
ARP4171-02 50 µg

Recombinant Human TFPI Protein

Sign In for Pricing
View Details
Recombinant Human TFPI Protein
ARP4171-03 100 µg

Recombinant Human TFPI Protein

Sign In for Pricing
View Details
Recombinant Human TFPI Protein
ARP4171-04 1 mg

Recombinant Human TFPI Protein

Sign In for Pricing
View Details