Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC3 Peptide - N-terminal region

TRAPPC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BET3

UniProt

O43617

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAPPC3 Rabbit Polyclonal Antibody (orb586521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055223

Preservative

Lyophilized powder

AA Sequence

TQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3K Antibody
CSB-PA693741 100 µL

EIF3K Antibody

Sign In for Pricing
View Details
CKM Antibody, FITC conjugated
A43822-50UG 50 µg

CKM Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-HBEGF Antibody (KHK2866)
F1904-.1 100 µg

Anti-HBEGF Antibody (KHK2866)

Sign In for Pricing
View Details
AMPD2 inhibitor 1 25mg
A19839-25 25 mg

AMPD2 inhibitor 1 25mg

Sign In for Pricing
View Details
ST2 Antibody
MBS186341-01 1 mg

ST2 Antibody

Sign In for Pricing
View Details
ST2 Antibody
MBS186341-02 2x 1 mg

ST2 Antibody

Sign In for Pricing
View Details