Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF17 Peptide - middle region

FGF17 Peptide - middle region

Product Specifications

Product Name Alternative

FGF-13

UniProt

O60258

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF17 Rabbit Polyclonal Antibody (orb585875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003858

Preservative

Lyophilized powder

AA Sequence

KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGLN1 (NM_022051) Human Over-expression Lysate
LC402911 20 µg

EGLN1 (NM_022051) Human Over-expression Lysate

Sign In for Pricing
View Details
CD74 (BU45), Biotin conjugate, 0.1mg/mL
BNCB0189-100 1x 100 µL

CD74 (BU45), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560029 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS806805 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
16Alpha-Bromodehydro Epiandrosterone
TRC-B682800-25MG 25 mg

16Alpha-Bromodehydro Epiandrosterone

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF405S conjugate, 0.1mg/mL
BNC043636-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details