Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF17 Peptide - middle region

FGF17 Peptide - middle region

Product Specifications

Product Name Alternative

FGF-13

UniProt

O60258

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF17 Rabbit Polyclonal Antibody (orb585875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003858

Preservative

Lyophilized powder

AA Sequence

KLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boron trifluoride acetic acid complex
TRC-B675630-5G 5 g

Boron trifluoride acetic acid complex

Sign In for Pricing
View Details
ETFA (C-term) Rabbit Polyclonal Antibody
AP51468PU-N 400 µL

ETFA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C5orf35 (SETD9) (NM_153706) Human Recombinant Protein
TP306225 20 µg

C5orf35 (SETD9) (NM_153706) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Cryab activation kit by CRISPRa
GA200895 1 Kit

Mouse Cryab activation kit by CRISPRa

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF568 conjugate, 0.1mg/mL
BNC682160-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR32 (NM_001506) Human Over-expression Lysate
LY400579 100 µg

GPR32 (NM_001506) Human Over-expression Lysate

Sign In for Pricing
View Details