Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOSLG Peptide - N-terminal region

ICOSLG Peptide - N-terminal region

Product Specifications

Product Name Alternative

B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS

UniProt

O75144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICOSLG Rabbit Polyclonal Antibody (orb585837) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056074

Preservative

Lyophilized powder

AA Sequence

VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK2 (NM_002497) Human Over-expression Lysate
LY419288 100 µg

NEK2 (NM_002497) Human Over-expression Lysate

Sign In for Pricing
View Details
Glycocholic Acid Hydrate Sodium Salt
TRC-G641360-50G 50 g

Glycocholic Acid Hydrate Sodium Salt

Sign In for Pricing
View Details
CD34 Mouse Monoclonal Antibody [Clone ID: EQ-8D11-C1]
AM32448PU-N 100 µg

CD34 Mouse Monoclonal Antibody [Clone ID: EQ-8D11-C1]

Sign In for Pricing
View Details
Insyn1 Mouse Gene Knockout Kit (CRISPR)
KN500480 1 Kit

Insyn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) ELISA Kit
RDR-HPR-Hu-01 96 Tests

Human Haptoglobin Related Protein (HPR) ELISA Kit

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) ELISA Kit
RDR-HPR-Hu-02 48 Tests

Human Haptoglobin Related Protein (HPR) ELISA Kit

Sign In for Pricing
View Details