Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGA3 Peptide - middle region

PGA3 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp666J2410, PGA4, PGA5

UniProt

P0DJD8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGA3 Rabbit Polyclonal Antibody (orb586417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073275

Preservative

Lyophilized powder

AA Sequence

ISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARG, CT (Poly (ADP-ribose) Glycohydrolase, Poly (ADP-ribose) Glycohydrolase, PARG99, FLJ54459, FLJ60257, FLJ60456) (MaxLight 405) discontinued
P3109-97C-ML405 100 µL

PARG, CT (Poly (ADP-ribose) Glycohydrolase, Poly (ADP-ribose) Glycohydrolase, PARG99, FLJ54459, FLJ60257, FLJ60456) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RHOT1P1 3'UTR GFP Stable Cell Line
TU069893 1.0 mL

RHOT1P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
DLK1 Protein Vector (Mouse) (pPM-C-His)
PV172345 500 ng

DLK1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
IL36RN Mouse
PT-A03040-01 2 µg

IL36RN Mouse

Sign In for Pricing
View Details
IL36RN Mouse
PT-A03040-02 10 µg

IL36RN Mouse

Sign In for Pricing
View Details
IL36RN Mouse
PT-A03040-03 1 mg

IL36RN Mouse

Sign In for Pricing
View Details