Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR183 Peptide - C-terminal region

GPR183 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EBI2

UniProt

P32249

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR183 Rabbit Polyclonal Antibody (orb586484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004942

Preservative

Lyophilized powder

AA Sequence

SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFC2 Rabbit Polyclonal Antibody
TA379018 100 µL

NDUFC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Hydroxy Thiabendazole-13C2,15N
TRC-H961202-5MG 5 mg

5-Hydroxy Thiabendazole-13C2,15N

Sign In for Pricing
View Details
PCDH19 Rabbit Polyclonal Antibody
TA379676 100 µL

PCDH19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MiTF Recombinant Rabbit Monoclonal Antibody [JF100-01]
ET1702-86 100 µL

MiTF Recombinant Rabbit Monoclonal Antibody [JF100-01]

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL
BNC882314-100 1x 100 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine (Mixture of Diastereomers)
TRC-A173710-1MG 1 mg

N-Acetyl-S-(3,4-dihydroxybutyl)-L-cysteine (Mixture of Diastereomers)

Sign In for Pricing
View Details