Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR183 Peptide - C-terminal region

GPR183 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EBI2

UniProt

P32249

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR183 Rabbit Polyclonal Antibody (orb586484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004942

Preservative

Lyophilized powder

AA Sequence

SLPWILLGACFIGYVLPLIIILICYSQICCKLFRTAKQNPLTEKSGVNKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lomitapide
TRC-L469435-5MG 5 mg

Lomitapide

Sign In for Pricing
View Details
Bis (2-Ethylhexyl) 4,4’-(6-(4-(ethoxycarbonyl)phenylamino)-1,3,5-triazine-2,4-diyl)bis(azanediyl)dibenzoate
TRC-B433845-100MG 100 mg

Bis (2-Ethylhexyl) 4,4’-(6-(4-(ethoxycarbonyl)phenylamino)-1,3,5-triazine-2,4-diyl)bis(azanediyl)dibenzoate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS640170 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Recombinant Human WWP2 Protein (His & GST Tag)
PKSH030722 100 µg

Recombinant Human WWP2 Protein (His & GST Tag)

Sign In for Pricing
View Details
EnzyFluo™ Human/Mouse GSK3A (S21) Phosphorylation ELISA Kit
EGSK3A-100 100 Tests

EnzyFluo™ Human/Mouse GSK3A (S21) Phosphorylation ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IDO1/IDO Protein (Gly&Ala2-Gly403)
PKSH030356 50 µg

Recombinant Human IDO1/IDO Protein (Gly&Ala2-Gly403)

Sign In for Pricing
View Details