Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRKL Peptide - middle region

CRKL Peptide - middle region

Product Specifications

UniProt

P46109

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRKL Rabbit Polyclonal Antibody (orb329575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005198

Preservative

Lyophilized powder

AA Sequence

RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit
orb779674-01 48 Tests

Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit
orb779674-02 96 Tests

Rat Platelet Derived Growth Factor Receptor Alpha (PDGFRa) ELISA Kit

Sign In for Pricing
View Details
Semaglutide Impurity 135
RM-S400135-01 10 mg

Semaglutide Impurity 135

Sign In for Pricing
View Details
Semaglutide Impurity 135
RM-S400135-02 100 mg

Semaglutide Impurity 135

Sign In for Pricing
View Details
Semaglutide Impurity 135
RM-S400135-03 25 mg

Semaglutide Impurity 135

Sign In for Pricing
View Details
Semaglutide Impurity 135
RM-S400135-04 50 mg

Semaglutide Impurity 135

Sign In for Pricing
View Details