Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRKL Peptide - middle region

CRKL Peptide - middle region

Product Specifications

UniProt

P46109

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRKL Rabbit Polyclonal Antibody (orb329575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005198

Preservative

Lyophilized powder

AA Sequence

RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK (IRAK1) (NM_001025243) Human Tagged Lenti ORF Clone
RC204869L3 10 µg

IRAK (IRAK1) (NM_001025243) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ifltd1 ORF Vector (Mouse) (pORF)
24242014 1.0 µg DNA

Ifltd1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-Protective Antigen 83 (PA83; B Anthracis) IgG-biotinylated
PA16-AB 50 µg

Anti-Protective Antigen 83 (PA83; B Anthracis) IgG-biotinylated

Sign In for Pricing
View Details
MSL3L1 Double Nickase Plasmid (h2)
sc-407378-NIC-2 20 µg

MSL3L1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Rabbit Polyclonal TBX5 Antibody
NBP2-55931-25ul 25 µL

Rabbit Polyclonal TBX5 Antibody

Sign In for Pricing
View Details
EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (HRP)
MBS6182327-01 0.1 mL

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (HRP)

Sign In for Pricing
View Details