Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIPR1 Peptide - middle region

GLIPR1 Peptide - middle region

Product Specifications

Product Name Alternative

CRISP7, GLIPR, RTVP1

UniProt

P48060

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLIPR1 Rabbit Polyclonal Antibody (orb586028) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006842

Preservative

Lyophilized powder

AA Sequence

SLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSVL6 Double Nickase Plasmid (h2)
sc-405327-NIC-2 20 µg

ACSVL6 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human SPIN1 Protein, N-His
E55P3310 50 µg

Recombinant Human SPIN1 Protein, N-His

Sign In for Pricing
View Details
CNOT3 Antibody (N-term)
MBS9208870-01 0.08 mL

CNOT3 Antibody (N-term)

Sign In for Pricing
View Details
CNOT3 Antibody (N-term)
MBS9208870-02 0.4 mL

CNOT3 Antibody (N-term)

Sign In for Pricing
View Details
CNOT3 Antibody (N-term)
MBS9208870-03 5x 0.4 mL

CNOT3 Antibody (N-term)

Sign In for Pricing
View Details
LRP2BP Human Over-expression Lysate
orb1369894 20 µg

LRP2BP Human Over-expression Lysate

Sign In for Pricing
View Details