Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC61A1 Peptide - C-terminal region

SEC61A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSEC61, SEC61, SEC61A

UniProt

P61619

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC61A1 Rabbit Polyclonal Antibody (orb326528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037468

Preservative

Lyophilized powder

AA Sequence

TWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTAAAFGGLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutelin Microplate Assay Kit
RDSM183 100 Assays

Glutelin Microplate Assay Kit

Sign In for Pricing
View Details
IL18 Antibody
KC-679-01 50 μL

IL18 Antibody

Sign In for Pricing
View Details
IL18 Antibody
KC-679-02 100 µL

IL18 Antibody

Sign In for Pricing
View Details
IL18 Antibody
KC-679-03 1 mL

IL18 Antibody

Sign In for Pricing
View Details
Smg1 Recombinant Rabbit Monoclonal Antibody [JE38-38]
HA722452 100 µL

Smg1 Recombinant Rabbit Monoclonal Antibody [JE38-38]

Sign In for Pricing
View Details
Cabp5 Mouse Gene Knockout Kit (CRISPR)
KN502407 1 Kit

Cabp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details