Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK2 Peptide - C-terminal region

GALK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GK2, MGC1745

UniProt

Q01415

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK2 Rabbit Polyclonal Antibody (orb586476) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002035

Preservative

Lyophilized powder

AA Sequence

TVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5E1]
TA802824 100 µL

OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5E1]

Sign In for Pricing
View Details
Immortalized Hamster Hepatocytes (SV40)
T0072 1x106 cells / 1.0 mL

Immortalized Hamster Hepatocytes (SV40)

Sign In for Pricing
View Details
Nano-Tag (9) Mouse mAb, RBITC conjugated
orb1084173 100 µL

Nano-Tag (9) Mouse mAb, RBITC conjugated

Sign In for Pricing
View Details
EZ-Pierce polyethylene film, 2.75 mil thick, -40C to +90C, non-sterile, 100/box
2930-7100 100/Box

EZ-Pierce polyethylene film, 2.75 mil thick, -40C to +90C, non-sterile, 100/box

Sign In for Pricing
View Details
CYM50308
MBS5754758 Inquire

CYM50308

Sign In for Pricing
View Details
RERGL Human shRNA Plasmid Kit (Locus ID 79785)
TL307290 1 Kit

RERGL Human shRNA Plasmid Kit (Locus ID 79785)

Sign In for Pricing
View Details