Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB30 Peptide - C-terminal region

RAB30 Peptide - C-terminal region

Product Specifications

UniProt

Q15771

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB30 Rabbit Polyclonal Antibody (orb586511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055303

Preservative

Lyophilized powder

AA Sequence

EIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRBP (TARBP2) (NM_134324) Human Tagged ORF Clone
RG213894 10 µg

TRBP (TARBP2) (NM_134324) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human DDB1 Protein, C-His
orb2963459-01 50 µg

Recombinant Human DDB1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human DDB1 Protein, C-His
orb2963459-02 100 µg

Recombinant Human DDB1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human DDB1 Protein, C-His
orb2963459-03 1 mg

Recombinant Human DDB1 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human NECTIN2 protein, C-Fc Tag
IMP-244 100 µg

Recombinant Human NECTIN2 protein, C-Fc Tag

Sign In for Pricing
View Details
Hspb7 Rabbit Polyclonal Antibody
orb578133 100 µL

Hspb7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details