Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB30 Peptide - C-terminal region

RAB30 Peptide - C-terminal region

Product Specifications

UniProt

Q15771

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB30 Rabbit Polyclonal Antibody (orb586512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055303

Preservative

Lyophilized powder

AA Sequence

ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-STAT5a(S726) Antibody Blocking peptide
MBS9225075-01 0.5 mg

Phospho-STAT5a(S726) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-STAT5a(S726) Antibody Blocking peptide
MBS9225075-02 5x 0.5 mg

Phospho-STAT5a(S726) Antibody Blocking peptide

Sign In for Pricing
View Details
STFR W019-450x150-AL-CRD/1 AC Signs
829162 Card of 1 Pictogram(s)

STFR W019-450x150-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
PIGV CRISPRa sgRNA lentivector (set of three targets)(Human)
36666121 3x 1.0µg DNA

PIGV CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei ybiX Protein (aa 1-225)
VAng-0329Lsx-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei ybiX Protein (aa 1-225)

Sign In for Pricing
View Details
IL-16 Polyclonal Antibody
ABP52906-01 30 µL

IL-16 Polyclonal Antibody

Sign In for Pricing
View Details