RAB30 Peptide - C-terminal region
RAB30 Peptide - C-terminal region
Product Specifications
UniProt
Q15771
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAB30 Rabbit Polyclonal Antibody (orb586512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055303
Preservative
Lyophilized powder
AA Sequence
ERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
JOT-EK6969Hu-01 96 Well
Human Ubiquitin Carboxyl Terminal Hydrolase L3,UCHL3 ELISA KIT
Sign In for Pricing
View Details JOT-EK6969Hu-02 48 Well
Human Ubiquitin Carboxyl Terminal Hydrolase L3,UCHL3 ELISA KIT
Sign In for Pricing
View Details VAng-Lsx05120-500gEcoli 500 µg (E. coli)
Recombinant Mycoplasma Pneumoniae pdhA Protein (aa 1-358)
Sign In for Pricing
View Details 