Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC3L2 Peptide - C-terminal region

EXOC3L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ36147, MGC16332, XTP7

UniProt

Q2M3D2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC3L2 Rabbit Polyclonal Antibody (orb586473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612635

Preservative

Lyophilized powder

AA Sequence

GAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal LOX-1/OLR1 Antibody (214012) [Janelia Fluor 549]
FAB1564I 0.1 mL

Rat Monoclonal LOX-1/OLR1 Antibody (214012) [Janelia Fluor 549]

Sign In for Pricing
View Details
LYVE1 Rabbit Polyclonal Antibody
E28PN2185 100 µL

LYVE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IGFBP6/IBP-6 Protein, His Tag
E40KMP1164 20 µg

Recombinant Human IGFBP6/IBP-6 Protein, His Tag

Sign In for Pricing
View Details
TRAPPC2L Human siRNA Oligo Duplex (Locus ID 51693)
SR309918 1 Kit

TRAPPC2L Human siRNA Oligo Duplex (Locus ID 51693)

Sign In for Pricing
View Details
Recombinant Human cAMP-regulated phosphoprotein 21
BP2114-50ug 50 µg

Recombinant Human cAMP-regulated phosphoprotein 21

Sign In for Pricing
View Details
Human FGF R3 (IIIb) Protein, Fc Tag
orb1146975-01 100 µg

Human FGF R3 (IIIb) Protein, Fc Tag

Sign In for Pricing
View Details