Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC3L2 Peptide - C-terminal region

EXOC3L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ36147, MGC16332, XTP7

UniProt

Q2M3D2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC3L2 Rabbit Polyclonal Antibody (orb586473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612635

Preservative

Lyophilized powder

AA Sequence

GAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FGA antibody
STJ118044 100 µl

Anti-FGA antibody

Sign In for Pricing
View Details
COQ4 3'UTR Lenti-reporter-Luc Vector
16644081 1.0 µg

COQ4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TAF1A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-12894R-BF405-01 20 µL

TAF1A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
TAF1A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-12894R-BF405-02 100 µL

TAF1A Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GRM4 siRNA (Rat)
MBS8201400-01 15 nmol

GRM4 siRNA (Rat)

Sign In for Pricing
View Details
GRM4 siRNA (Rat)
MBS8201400-02 30 nmol

GRM4 siRNA (Rat)

Sign In for Pricing
View Details